GRAFISCH & VOORNIX

grafisch-voornix-logo

Graphical & Voornix is ​​a design agency that renders graphic design, concept design, typography, signpainting and illustration.

#SimilarOrganizations #Website #More

GRAFISCH & VOORNIX

Industry:
Advertising Graphic Design Printing

Founded:
2007-10-01

Address:
Maastricht, Limburg, The Netherlands

Country:
The Netherlands

Website Url:
http://www.grafischenvoornix.nl

Total Employee:
1+

Status:
Active

Contact:
+31 64 3219358

Email Addresses:
[email protected]

Technology used in webpage:
Content Delivery Network Font Awesome Apache Google Maps JsDelivr BootstrapCDN Sectigo SSL Sectigo Domain SSL Typekit Adobe Muse


Similar Organizations

reclamit-logo

Reclamit

Reclamit is an advertising agency that renders graphic design, lamination, metal lettering, painting, and technical assistance.

Official Site Inspections

http://www.grafischenvoornix.nl

  • Host name: srv20881.flexwebhosting.nl
  • IP address: 185.89.4.81
  • Location: Netherlands
  • Latitude: 52.3824
  • Longitude: 4.8995
  • Timezone: Europe/Amsterdam

Loading ...

More informations about "Grafisch & Voornix"

Grafisch & VoornixOntwerpbureau Grafisch & Voornix

If you are looking for a way to develop your ideas or simply in need of a solid and creative concept, than look no further. At Grafisch & Voornix we create and develop ideas into …See details»

AboutOntwerpbureau Grafisch & Voornix - grafischenvoornix.nl

Grafisch & Voornix is een ontwerpbureau en ontwerpt al meer dan 20 jaar voor verschillende opdrachtgevers. We zijn gespecialiseerd in originele en passende oplossingen en uitvoering …See details»

Grafisch & Voornix - Crunchbase Company Profile & Funding

Graphical & Voornix is a design agency that renders graphic design, concept design, typography, signpainting and illustration.See details»

ContactOntwerpbureau Grafisch & Voornix - grafischenvoornix.nl

All images & artwork © Grafisch & Voornix 2007-2019. CONTACT INFO. +31 (0)6 43219358. [email protected]See details»

Grafisch & Voornix Maastricht - Telefoonboek.nl

Grafisch & Voornix in Maastricht, Merovingenstraat 61, 6224 HB - Telefoonnummer, informatie en kaart van Grafisch & Voornix - Rubriek ReclamebureauSee details»

Graphic Design Studios in the Netherlands - Dexigner

Dogandpony.nl. Oud-Zuid, Amsterdam. Marathon Studio. Marathon Studio is a graphic design and visual communication practice. ... we have the ability to shape and coordinate teams around …See details»

Grafischenvoornix.nl - Voornix gaat de... Traffic, Ranking

Grafischenvoornix.nl receives about n/a unique visitors per day, and it is ranked 14,727,554 in the world. grafischenvoornix.nl uses Apache, Font Awesome, RequireJS web technologies. …See details»

Café van Bommel - The voicemail of holland ️ ... - Facebook

Feb 19, 2022 The voicemail of holland ️ #vastelaovend #cafevanbommel #grafischenvoornix #platielstraatSee details»

GrafischeNet.nl

Grafischenet.nl is gemaakt door en voor het grafische bedrijfsleven en de sign sector. Op de portal vinden grafische managers, sign managers, grafische inkopers, sign inkopers en …See details»

charactersOntwerpbureau Grafisch & Voornix - grafischenvoornix.nl

Mascottes en characters geven een persoonlijke touch aan je bedrijf of product. Je boodschap krijgt een gezicht en ze zorgen voor herkenning en betrokkenheid bij de doelgroep.See details»

Grafein – Het draait om grafiek.

4 days ago Stichting Grafein initieert, faciliteert en participeert in grafiekprojecten in Nederland en in het buitenland om professionals en publiek, kunstenaars, instellingen en verzamelaars te …See details»

Organization | GWA - grafischewerkplaatsamsterdam.nl

Organization. sign up as a volunteer. internship. Team GWA. ANBI. ... The 2023 financial statements can be obtained from us at [email protected]. NDSM …See details»

Examples of organizational constellations | Bert Hellinger Instituut

You take this backpack to work, into the organization. Your first employer is therefore your family, we tell participants. How patterns within the organizational system emerge. To understand …See details»

VRIJDAG - NEXT architects

The organization of the program arises from a clear cross of axes on the ground floor that connects the inner gardens of the composite building. The courtyard garden is a source of …See details»

About Grafein – Grafein

Grafein is an independent cultural public benefit organization (PBO – in Dutch: ANBI). ... Algemeen: [email protected] Expo en publicaties: [email protected] +31 6 1432 7420. …See details»

murals & moreOntwerpbureau Grafisch & Voornix

Grafisch & Voornix delivers a wide variety of possibilities for monumental presentations. Your company logo or a theme- based graffiti mural. Authentic and hip, we create a striking, …See details»

Dutch animal welfare organization rescues 12 lions from ... - NL …

1 day ago Dutch animal welfare organization Stichting AAP successfully rescued 12 lions from a French circus, marking the largest feline rescue in its history. The group included one male, …See details»

Francophone+municipal+organization - NL Classifieds

Find Francophone+municipal+organization in Agriculture | Find the latest new & used in farming equipment, tractors, trailers, livestock and more. Browse hundreds of local ads.See details»

posters 1Ontwerpbureau Grafisch & Voornix - grafischenvoornix.nl

Posters and handouts are still relevant despite the overall use of social media and can be of great importance for your promotion. Posting is a way to promote your company, event or product at …See details»

Dutch Grand Prix in Zandvoort disappearing from F1 calendar

23 hours ago The Formula 1 in Zandvoort will end in 2026. The contract between the Formula One Management (FOM) and the circuit will not be renewed after that, the organization …See details»

linkstock.net © 2022. All rights reserved