GRAFISCHEBRON
Grafischebron deals with textile printing, design and lettering.
GRAFISCHEBRON
Social Links:
Industry:
Printing Product Design Professional Services
Founded:
2001-02-01
Address:
Oostrum, Limburg, The Netherlands
Country:
The Netherlands
Website Url:
http://www.grafischebron.nl
Total Employee:
1+
Status:
Active
Contact:
+31-478 56 00 05
Technology used in webpage:
SPF SSL By Default Google Analytics Nginx IPv6 Sectigo SSL Sectigo Domain SSL Google Analytics Classic AddThis Browser-Update
Similar Organizations
AC Grafic Geldner
AC Grafic Geldner offers textile printing, vehicle lettering, promotional item services.
Briggs Bros
Briggs Bros provides in-house design, printing, graphic design, binding, and foiling services.
Cencio A/S
Cencio A/S specializes in textile printing, embroidery, design, and packaging services.
Official Site Inspections
http://www.grafischebron.nl
- Host name: web8.hostingcp.eu
- IP address: 88.214.28.11
- Location: Alkmaar Netherlands
- Latitude: 52.6321
- Longitude: 4.7246
- Timezone: Europe/Amsterdam
- Postal: 1816
More informations about "Grafischebron"
GrafischeBron.nl - Uw drukkerij, in regio Venray
Welkom op de website van de GrafischeBron! Kijk eens rustig rond wat wij voor u zouden kunnen betekenen. Wij zijn al 20 jaar bezig met het bedrukken en leveren van textiel, maken van beletteringen ... [email protected] of per telefoon …See details»
Grafischebron - Crunchbase Company Profile & Funding
Organization. Grafischebron . Connect to CRM . Save . Summary. People. Technology. ... Contact Email [email protected]; Phone Number +31-478 56 00 05; Products and …See details»
Grafischebron Company Profile | Oostrum LB, Limburg, …
Find company research, competitor information, contact details & financial data for Grafischebron of Oostrum LB, Limburg. Get the latest business insights from Dun & Bradstreet.See details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
Please type the letters and numbers shown in the image. Grotere kaart weergeven Routebeschrijving. GrafischeBron. De Voorde 8 5807EZ Oostrum. Tel: 0478 56 00 05 …See details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
GrafischeBron.nl, Kwalitatief materiaal, uitstekende service en uiterst betaalbaar. Wij bedrukken al meer als 15 jaar voor zowel bedrijven, verengingen, winkels en particulieren diverse textiel soorten op verschillende manieren.. Gaat het om …See details»
Grafische Bron Oostrum 5807 AD, Drukkerij - misterwhat.nl
Grafischebron. De Voorde 8 5807 EZ Oostrum. 556 mt. Drukshop Venray. De Voorde 8 5807 EZ Oostrum. 2 km. Munckhof BV vd. Keizersveld 19 5803 AM Venray. 3 km. Periodiek …See details»
noud hoek - Owner - grafischebron | LinkedIn
Owner, grafischebron Arnhem-Nijmegen en omgeving. Uw gedeelde connecties bekijken. Gemeenschappelijke connecties met noud weergeven Aanmelden Welkom terug E-mail of …See details»
L Gruzen - Algemeen directeur - Grafischebron - LinkedIn
Algemeen directeur bij Grafischebron · Ervaring: Grafischebron · Locatie: Arnhem-Nijmegen en omgeving · 12 connecties op LinkedIn. Bekijk het profiel van L Gruzen op LinkedIn, een …See details»
Grafischebron | Venray - Facebook
Grafischebron, Venraij. 142 likes · 12 were here. Ontwerp - Drukwerk - Textieldruk - Belettering - Groot formaat printwerkSee details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
GrafischeBron.nl, Kwalitatief materiaal, uitstekende service en uiterst betaalbaar. Ontwerpen. Naar aanleiding van de wensen van de klant maken wij een ontwerpSee details»
GrafischeBron - Stagemarkt.nl
GrafischeBron. Naam GrafischeBron; Leerbedrijf ID 100709312; KvK naam GrafischeBron; KvK nummer 12043741; Erkenningen. Sector: Entree. Assistent logistiek (25743) niveau 1 / 31-1 …See details»
GrafischeBron - Stagemarkt.nl
Profiel van GrafischeBron. niveau 1 / 31-1-2022 Werkt als assistent in een arbeidsorganisatie (B1-K1)See details»
Christina Koikaran - Parliamentary Intern - LinkedIn
Political Science BA Graduate from McGill University | Double Minor in Indigenous Studies and Gender, Sexuality, Feminism & Social Justice | Parliamentary Intern (PIP - PSP) · Hello! My …See details»
Organization | GWA - grafischewerkplaatsamsterdam.nl
Organization. sign up as a volunteer. internship. Team GWA. ANBI. ... The 2023 financial statements can be obtained from us at [email protected]. NDSM …See details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
Grafische Bron-De Voorde 8-5807EZ Oostrum-0478-560 [email protected]. Home; Ontwerpen; Drukwerk; Belettering; Posters; Doeken. Rolbanners; Reclame Doeken; ...See details»
Grafein – Het draait om grafiek.
Stichting Grafein initieert, faciliteert en participeert in grafiekprojecten in Nederland en in het buitenland om professionals en publiek, kunstenaars, instellingen en verzamelaars te blijven …See details»
Grafiekplatform - Vereniging voor hedendaagse grafische kunst
Grafiekplatform is een landelijke vereniging van grafische kunstenaars, grafiekwerkplaatsen, musea, galeries, uitgeverijen en verzamelaars. Kwaliteit van en passie voor grafiek staan …See details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
Grafische Bron-De Voorde 8-5807EZ Oostrum-0478-560 [email protected]. Home; Ontwerpen; Drukwerk; Belettering; Posters; Doeken. Rolbanners; Reclame Doeken; Wand …See details»
orebroautomobil.se+organization - NL Classifieds
Find Orebroautomobil.se+organization in Lawn & Garden | Find new & used lawn & garden items for sale. Shop the latest items in lawn and garden including BBQs & grills, generators, snow …See details»
GrafischeBron.nl - Uw drukkerij, in regio Venray
GrafischeBron.nl, Kwalitatief materiaal, uitstekende service en uiterst betaalbaar. Posters. Wij kunnen posters leveren in alle formaten en alle aantallen. Of het nu om een enkele poster van …See details»