TURNAROUND GUIDE
LIFTING FALLING ANGELS Turnaround Guide is a tailored advisory firm working abroad and specializing in corporate turnaround, special situations, change management. CEO, owner & founder Raevskaya-Repnina. Raevskaya-Repnina is an entrepreneur, owner & founder of the BOOST private equity firm, HASHEIGHT techno corporation, 2R law firm, and TURNAROUND GUIDE tailored advisory company. Corporate turnaround expert with more than 20 years of successful track record in well-known companies, including... Fortune-500. Lawyer, economist, Oxford Business Alumni, a fellow of St Hugh's College, Saïd Business School. Dynast from the royal and noble-born ruling dynasties from Russia and abroad, grand-granddaughter of Nikolay Raevsky, the Russian General, a hero of the Napoleon war of 1812, and Nikolay Repnin, Field Marschal, Imperial Russian statesman, and general from the Repnin princely family. In 2014 Raevskaya-Repnina created the BOOST private equity firm with $83k of equity and turned this around to the largest private company. Now the BOOST is debt-free, profitable private equity firm running a $460 bln portfolio consisting of toxic assets and more than 30 disruptive startups. www.turnaroundguide.me #turnaroundguide #liftingfallingangels #turnaroundguideonline #raevskayarepnina #clevercard #corporateturnaround #businesstransformation #specialsituations #changemanagement #distress #restructuring #raevskayarepnina #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina#annamariaserafimaraevskayarepnina #startedinoxford #oxfordsbs #sthughscollege #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london #postcovidrehab #sme #superlarge #crossborder #emergingmarkets #crisis #losses #resilience #businesstips #postcovidrehab #sme #turnaround #freeadvisory #freemium #sharedeconomy #sharedservices #globalprocurement #sox404 #turnarounguide #raevskayarepnina #corporateturnaround #businesstransformation #specialsituations #changemanagement #distress #restructuring #liftingfallingangels #postcovidrehab #sme #superlarge #crossborder #emergingmarkets #oxfordbusinessalumni #saïdbusinessschool #startedinoxford #crisis #losses #russia #global #moscow #uk #pictureofaday #trendyquote #tips #women #womenfounders #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима
TURNAROUND GUIDE
Industry:
Education Financial Services Professional Services Project Management
Website Url:
http://www.turnaroundguide.me
Status:
Active
Contact:
+74957488178
Email Addresses:
[email protected]
Technology used in webpage:
Domain Not Resolving Euro IPv6 Pound Sterling Japanese Yen Reg.ru Hosted Reg.ru DNS
Similar Organizations
Cobrafix
Cobrafix is a debt collections company that specializes in credit recovery and people management solutions for the education sector.
Top Capital Partners Investimentos Ltda
Top Capital is a boutique investment firm focusing on corporate strategy, financial services, and capital markets.
Trefethen Advisors
Trefethen Advisors is an advisory firm that covers financial services, corporate finance, mergers & acquisitions and investment.
Current Employees Featured
Official Site Inspections
http://www.turnaroundguide.me
Unable to get host informations!!!
More informations about "TURNAROUND GUIDE"
TURNAROUND GUIDE - Crunchbase Company Profile & Funding
Organization. TURNAROUND GUIDE . Connect to CRM . Save ... private equity firm running a $460 bln portfolio consisting of toxic assets and more than 30 disruptive startups. …See details»
How to Implement a Successful Turnaround Strategy: A Step-by
Mar 11, 2024 The first step in implementing a successful turnaround strategy is to identify the root causes of your business's decline. This requires conducting an honest assessment of …See details»
Restructuring and Turnaround | EY - Canada
Organizational disruption is not new, but in today’s environment it has grown more complex. From geopolitical uncertainty, cross-border trade restrictions, technology and supply chain disruption …See details»
Turnaround Project Management Primer - InterPlan Systems
Company Turnarounds And How To Lead Them - Forbes
Aug 6, 2019 2. Focus on buy-in. Once you've bought into a turnaround, gather around you team members who also believe that a turnaround is possible. Every person on your team is either …See details»
Turnaround and restructuring - KPMG Canada
In an environment of unprecedented disruption and uncertainty Canadian companies face a host of complex problems. From supply chain disruption and evolving stakeholder and regulatory …See details»
Turnaround Management - Rescuing a Struggling Organization
An organization doesn't have to be in steep decline – or experiencing a cash crisis – for turnaround strategies to be useful and effective. Organizations that are underperforming or …See details»
Mastering Turnaround Management: A Comprehensive Guide
Aug 17, 2024 Delving into real-world transformations, we observe compelling narratives of organizations that have completely reversed their fortunes. A standout example involves a well …See details»
The Art of the Turnaround Book - Mike Dunlop
The Art of the Turnaround is a comprehensive, field-tested guide to turning around failing companies and organizations based on the decades of experience of Mike Dunlop. “The ten …See details»
Turnaround Strategies: Explained with examples and case study
A turnaround strategy is a plan for reorganizing and revitalizing a struggling business or organization. The following steps can help in developing a turnaround strategy: Identify the …See details»
The Turnaround Model: A Comprehensive Guide
Sep 30, 2024 A critical factor in XYZ organization's success was the meticulous tracking, analysis, and refinement of expenditures, underscoring the axiom that knowledge wields …See details»
BUILDING AN EFFECTIVE CORPORATE TURNAROUND …
TURNAROUND MANAGEMENT ORGANIZATION By Brett Schroeder Managing Director Co-Founder George Debakey Managing Director Co-Founder Corporate Office 3 Bethesda Metro …See details»
Understanding the Turnaround Meaning in Business
Aug 29, 2024 This strategic document serves as the foundation for both business and strategic planning, distinguishing successful ventures from those that falter. The difference lies in the …See details»
Lessons from a Turnaround Expert - Harvard Business Review
Aug 27, 2024 My organization, I didn’t make any mistakes, etc.,” I pretty much thought they wouldn’t make the cut long. And that’s generally how it worked out. So right away, I am, if you …See details»
How to Recover & Accomplish a Turnaround — 501 Commons
This transition team will partner with the turnaround consultant(s) to lead the organization through the project. The next step is a deep assessment of the situation and fundamentals of the …See details»
Turnaround Strategy: A Guide To Efficient Execution - Cascade …
Sep 26, 2023 Use tools like Cascade's Alignment Map to visualize how different parts of the organization work together to achieve corporate objectives. You can also break down a …See details»
Execute a Turnaround Strategy in 6 Steps - Strategy Capstone
In this blog post, we’ll discuss the importance and impact a successful turnaround strategy can have on your organization’s bottom line; dive into some common types of strategies other …See details»
Turnaround services - Deloitte Canada
An organization needed assistance in the turnaround of a distressed car rental company under hard restructuring targets and tight timelines. Solution Identified financial and operational …See details»
How To Write a Turnaround Strategy — BMCO
Jan 7, 2021 As the world waits for a vaccine for the coronavirus, companies have time to make their turnaround strategy. This will determine if companies can reopen in full force once the …See details»
Restructuring and turnaround strategy | EY - Canada
Restructuring or turning around an organization brings many challenges on top of the daily demands of running a business, for example: managing competing agendas, creating time to …See details»