VAN RIJN SCHILDERWERKEN
Van Rijn Schilderwerken specializes in interior and exterior painting services.
VAN RIJN SCHILDERWERKEN
Industry:
Art Interior Design Outdoors
Founded:
1989-01-04
Address:
Utrecht, Utrecht, The Netherlands
Country:
The Netherlands
Website Url:
http://www.vanrijnschilderwerken.nl
Total Employee:
1+
Status:
Active
Contact:
030 254 13 38
Email Addresses:
[email protected]
Technology used in webpage:
LetsEncrypt IPv6 Apache JQuery CDN PHP Varnish One.com DNS
Similar Organizations
Avenir Rénovations
Avenir Rénovations specialized in interior and exterior renovations.
Bagnalls
Bagnalls offer industrial coatings, refurbishment, infrastructural paintings, decoration, national paintings & commercial painting services.
Fön, design_
fön, design_ specializes in interior designing services.
Pablo Méndez Performances
Pablo Mendez Performances specializes in designing and executing shows.
Thézé Painting
Thézé Painting is a painting company that specializes in interior and exterior painting services.
Zo.Lies
Zo.Lies is a company specialized in interior designing services.
Zoë Design
Zoë Design specializes in interior design services.
Official Site Inspections
http://www.vanrijnschilderwerken.nl
- Host name: webcluster2.webpod12-cph3.one.com
- IP address: 46.30.213.33
- Location: Copenhagen Denmark
- Latitude: 55.6786
- Longitude: 12.5589
- Timezone: Europe/Copenhagen
- Postal: 1052
More informations about "Van Rijn Schilderwerken"
Van Rijn | Schilderwerken Beglazing Reclamebelletering
Van Rijn Schilderwerken is een klein bedrijf in Utrecht dat sinds zijn oprichting in 1989 een goede naam heeft opgebouwd. We staan in voor professioneel en duurzaamSee details»
Van Rijn Schilderwerken - Crunchbase Company Profile & Funding
Van Rijn Schilderwerken specializes in interior and exterior painting services. There is no recent news or activity for this profile. Where is Van Rijn Schilderwerken's headquarters? Van Rijn …See details»
Schilderwerken Beglazing Reclamebelletering - Van Rijn
Werkzaamheden. binnen- en buitenschilderwerken; wandafwerkingen, o.a. schilderen buitengevels, aanbrengen van glasweefsel,waterafstotend maken vanSee details»
Annual Returns - Digital Government and Service NL
Van Rijn Schilderwerken - schilderscout.nl
Www.vanrijnschilderwerken.nl . Stuur bericht . Ontdek de Prachtige Schilderkunst van Van Rijn Schilderwerken. Bent u op zoek naar een betrouwbare schilder in Utrecht Oost die uw huis …See details»
Vanrijnschilderwerken : vanrijnschilderwerken.com
Vanrijnschilderwerken.com is 7 years 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active …See details»
Organization | GWA - grafischewerkplaatsamsterdam.nl
The 2023 financial statements can be obtained from us at [email protected]. NDSM Square 27 1033 WC Amsterdam. Open: …See details»
WordPress.com
Log in to your WordPress.com account to manage your website, publish content, and access all your tools securely and easily.See details»
Organizational chart - NL Health Services
Organizational chart for the senior leadership team at NL Health Services. Download the chart (PDF).See details»
Van Rijn | Schilderwerken Beglazing Reclamebelletering
Door de nauwe samenwerking met een timmer- en loodgieterbedrijf kunnen wij adequaat reageren op problemen zoals houtrot of lekkages. een goede naam heeft opgebouwd. …See details»
Van Rijn | Schilderwerken Beglazing Reclamebelletering
Offerte. Voordat wij u een vrijblijvende offerte toesturen vindt er een opname plaats waarbij wij u adviseren over materiaal en kleurgebruik. Tevens inspecteren wijde algehele toestand van het …See details»
Modeling the Land Surface Phenological Responses of Dominant …
Modeling the Land Surface Phenological Responses of Dominant Miombo Tree Species to Climate Variability in Western TanzaniaSee details»
Newfoundland and Labrador Nonprofit Organizations
Using this form, we are able to capture vital information about your nonprofit organization (e.g., organization name, type, short description about what you do, contact information, social …See details»
Registry of Companies - Digital Government and Service NL
All corporations operating in the province must be registered with this registry. Adobe® Acrobat® Reader software can be used for viewing PDF documents. Download Acrobat® Reader for free.See details»
Director, Emerging Policies - Novartis
3 days ago · Key Responsibilities:Conduct structured, predictive policy horizon scanning to anticipate future developments in emerging policy areas with impactful implications for NVS …See details»
Sr. Specialist Workforce Enablement and Upskilling, Data
1 day ago · Role Responsibilities:Execute strategic initiatives: Implement initiatives across productivity, capability building and workforce strategy.Support Organisation Design initiatives: …See details»
Homepage - SPCA St. John's
The SPCA St. John’s is an adoption-focused agency helping homeless animals find happy beginnings. We also work encourage and assist with spaying and neutering across the Avalon …See details»
Nonprofit Organizations Listing - Volunteer St. John's, NL
Using this form, we are able to capture vital information about your nonprofit organization (e.g., organization name, type, short description about what you do, contact information, social …See details»
Synergistic Nonreciprocity of Linear and Nonlinear Optical …
3 days ago · Linear optical diffraction of light is a basic natural phenomenon subject to a long history study and it obeys the well-known reciprocity in transport. In this work we report …See details»
Google Translate
Deze kosteloze service van Google kan woorden, zinnen en webpagina's onmiddellijk vertalen tussen het Nederlands en meer dan 100 andere talen.See details»