WEIDE
Weide specializes in developing corporate identity and effective marketing strategy, graphics, websites, social media and email marketing.
WEIDE
Industry:
Advertising Graphic Design Internet Social Media Web Development
Founded:
2006-01-01
Address:
Havelte, Drenthe, The Netherlands
Country:
The Netherlands
Website Url:
http://www.weide-ic.nl
Status:
Active
Contact:
+31 0 521 34 30 81
Email Addresses:
[email protected]
Technology used in webpage:
IPhone / Mobile Compatible SSL By Default Google Tag Manager Apache Microsoft Exchange Online Amazon Office 365 Mail Microsoft Azure DNS Apache 2.4 Sectigo SSL
Similar Organizations
Clormann Design
Clormann Design specializes in logo development, corporate and packaging design, campaigns, website creation, and branding.
Esjaem LLC
Esjaem is a website that will help your firm maximize its online marketing potential while also assisting with website management.
Face First Creative
Face First Creative provides web design, web development, corporate identity, graphic design, social media, and inbound marketing services.
Octagono
Octagono specializes in e-commerce solutions, content management, corporate identity, social media, and web development.
Up Digital
UP digital provides web design and development services that offer web development, graphic design, social media marketing, and SEO.
wolfrum.de
Wolfrum.de is to develop and operate online marketing platforms, internet media and local portals.
Zoofa Design
Zoofa specializes in customized graphic design, web development, digital strategy, SEO, analytics, social media and email marketing.
Official Site Inspections
http://www.weide-ic.nl
- Host name: 167.99.17.211
- IP address: 167.99.17.211
- Location: Amsterdam Netherlands
- Latitude: 52.352
- Longitude: 4.9392
- Timezone: Europe/Amsterdam
- Postal: 1098
More informations about "Weide"
Weide marketing, ontwerp & interactie B.V. - Stagemarkt.nl
KvK naam Weide marketing, ontwerp & interactie B.V. KvK nummer 69176132; KvK vestigingsnummer 000037546384; ... (NL). Resultaatgerichte denkers en doeners, met liefde …See details»
Impressum | Revamo.nl
De website www.revamo.nl is eigendom van Revamo B.V.. Adresgegevens. Revamo B.V. Pieter Mastebroekweg 2-A 7942 JZ Meppel. E-Mail: [email protected] Beheer. Roelof Vedder. …See details»
Weidecom
Weidecom. Uw computer-specialist en WiFi-expert aan huis sinds 2005. Weidecom is de ‘one stop’ voor al uw ICT gerelateerde problemen. Wij adviseren, analyseren, repareren en zorgen …See details»
ICANN Lookup
The ICANN registration data lookup tool gives you the ability to look up the current registration data for domain names and Internet number resources.See details»
Home • Lage Weide
Feb 26, 2024 Wij werken aan een schoon, heel en veilig Lage Weide, we zijn de spreekbuis van ondernemers richting politiek en ambtenaren en we organiseren events voor ondernemers. 06 …See details»
Mark van der Weide - FOUNDER & OWNER - LinkedIn
Founder & owner at ThisPlays® Int. - revolutionizing photo booths · Ervaring: ThisPlays® International · Opleiding: Hotelschool The Hague · Locatie: …See details»
Renée L.M. van der Reep - Docente Duits & Sectievoorzitter
Docente Duits & Sectievoorzitter bij Oosterlicht College Nieuwegein · Teacher German, language specialist, (intercultural) communicator, connector & multilingual voice over …See details»
Organization | GWA - grafischewerkplaatsamsterdam.nl
Organization. sign up as a volunteer. internship. Team GWA. ... Liesbeth van der Weide Peter Jan Nicolai Emma Kropman Juan Badia Alette de Roos Juliette Verberne Maaike Bol Ed Visser . …See details»
Karsten Weide - W Media Research - LinkedIn
Advertising and media & entertainment expertise. Consulting, thought leadership, custom… · Experience: W Media Research · Education: Leibniz Universität Hannover · Location: San …See details»
Women Exporters in the Digital Economy (WEIDE) Fund
Women entrepreneurs from the Dominican Republic, Jordan, Mongolia, and Nigeria are eligible to apply for the WEIDE Fund through selected Business Support Organizations. The selection …See details»
1.755 vacatures voor Process consultant in Lage Weide - glassdoor.nl
Zoek naar vacatures voor Process consultant in Lage Weide met bedrijfsreviews en salarissen. 1.755 vacatures voor Process consultant in Lage Weide.See details»
CLAFIS padel-toernooi – RC de Weide
Baan reserveren niet leden. Weergegevensbron: weer Hoogeveen ZoekenSee details»
Wijkvereniging De Weide | het hart van de wijk! – De vereniging …
Wijkvereniging De Weide is een bruisende vereniging met als thuisbasis ons wijkcentrum “De Weideblik”. Van hieruit organiseren en faciliteren we al meer dan 50 jaar een scala aan …See details»
Deelfietsensysteem Lage Weide: gratis met de e-bike naar je werk!
Jun 19, 2023 Parkmanagement Lage Weide is opgericht op initiatief van Industrievereniging Lage Weide (ILW). Deze werkstichting creëert de verbinding tussen de circa 800 bedrijven die …See details»
Hoe kom je bij Walther Boer Weide in 'S-Gravenhage met bus
Trein: IC, SPR. Metro: E. Tram ... De dichtstbijzijnde stations bij Walther Boer Weide zijn: Den Haag, Boslaan is 317 meter verwijderd, 5 minuten wandelen. 'S-Gravenhage, Koningin …See details»
Project Hiddinks Weide te HENGELO (GLD) - Roosdom Tijhuis
De gemeente Bronckhorst heeft de locatie “Hiddink Weide” aan de noordzijde van de Regelinklaan aangewezen als locatie voor de uitbreiding van Hengelo (Gld.) in de komende …See details»
Mijn Weide
Welkom op mijn digitale Weide! Een artistieke ontdekkingstuin waarin je vrij kunt struinen door mijn binnenwereld.See details»
Stal en weide verhuur/verkoop | Facebook
Deze groep is bedoeld voor mensen die een stal of weide te huur of te koop aanbieden, tevens zelf op zoek zijn hier naar. Niet de bedoeling om spullen zoals zadels etc te koop te zetten, …See details»
Inrichten weide, welke indeling - Bokt.nl
Jul 13, 2013 De rest van de weide zou ik rondom afrasteren en gaan werken met strookbegrazing. Is de strook gras te krap om lekker te rennen dan de bak er bij open, anders …See details»
Advocacy & Education Officer - SEA Project - glassdoor.ca
Association for New Canadians is a non-profit, community-based organization dedicated to. the provision of settlement and integration services for immigrants and refugees. Job Title: …See details»